N-Glycosylated Protein Data

Protein Summary

ID: LOC553337 protein
Protein Name: LOC553337 protein
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
597 (K)TQADGVSDNInK(T) Trypsin 631.8 1261.58 2 95% 32.83 23.26

Protein Sequence

gglclkclyntdgdscsecklgyygnaliqdcrrctcvtagtlpnsctdgvcqcdkqtgq
cpckqniighncdqcatnhwnfgsdcgcepcgcvqpnalsthcnmfsgqchcqpgfggrq
cneceafhwgdprvqceecnchplgsetsqcdrttgacvckdgasgqrcdecargftgnf
pkcvpchpcfqlwddvvcqvrrdlthfrdiiamilekgevpgvsdkrilelekklaqaqe
lvrdgdregtfnlisqtvddlraeialtdgrlmgvirdlnvttdhnndlkqnltalekel
kdlnntlhqlrrelenyltaglaeqfanvlkyyqrslnseqrcnasvygpqspveqsqdt
rnrteallkdkkdsllrtatannkslselegkaheinrkvhhlsnkvcgghangnvngsc
eespcggagcrgsdgvlkcggrgcngtvgasvkaldnadevhknltavseelqtmakklr
diatltqtvktqaketldkaqnkkdmfeksnkmlknfiqkikdflneegadpesiekvaq
qvlaislpvnrtvivnlveqikdsivnltnvegvfnhtseqlakvndllkkaqda[kTQA
DGVSDNINK
t]kealetsqnakkkkkkkkk

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University