N-Glycosylated Protein Data

Protein Summary

ID: LOC553381 protein
Protein Name: LOC553381 protein
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
84 (K)VLLEnATVAK(E) Trypsin 529.81 1057.6 2 95% 56.85 23.84
99 (R)KnVTLEGDSIQAAHSK(L) Trypsin 566.96 1697.86 3 95% 53.66 24.96

Protein Sequence

maeasvdgakmtespventtvrsenktqgnsffswilvlgllgawlsvgvvwfdivdyns
vadvlggvydadgdgdfdvqda[kvllenatvake]kti[rKNVTLEGDSIQAAHSKl]t
yervkevglkregehptrdigrklktalkeqlriihekieakkiaklalaevrsvlaqee
eerqatlaakkakeeaeaklkeerfqreqdkklakekaerermeqekmakekaekekaek
krldeeknekerlekekaekekaekerlakekaekerlakekaekeriekekaekkkkk

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University