N-Glycosylated Protein Data

Protein Summary

ID: PREDICTED: serpin peptidase inhibitor, clade F, member 2, like
Protein Name: PREDICTED: serpin peptidase inhibitor, clade F, member 2, like
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
273 (K)LnISDMYAR(F) Trypsin 550.2615 1,098.51 2 95% 23.16 22.10

Protein Sequence

mkhyllvlilpfsfnfgllasnetgdakekcndvlglesqravgaavaklgltlleklqp
gseqpniiisplsvslalaelalgarnnteekllevlhakelphfhetlsclqehltaka
vkmasrlylvpgytvnpdfvdralnlyksesaqltsiedvnrwveettngqitnfmsslp
pnvvlmlinaihfkgewqsrfnskytkenifhidrktsvkvdmmmgsqyplsmfvdrtdg
tqvarlpfrgnmsllvimprlqhenlsnvaa[kLNISDMYARf]prersmhvtlpkfkle
ykqdlrqaltsmglgflftgpdlsriapgplvvsgvqhasnmelseegaeasaatsftlv
rtisffsvnmpfifalvddtsytplflgivtnpnpgakteqsddpktetestrksskdpm
sdgtlndgphqnmlsymlnmwketvpqqflghqemedgn

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University