N-Glycosylated Protein Data

Protein Summary

ID: PREDICTED: similar to lysosomal-associated membrane protein 2 isoform 2
Protein Name: PREDICTED: similar to lysosomal-associated membrane protein 2 isoform 2
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
57 (R)GNYnVTNAnDTVCLLAR(M) Trypsin 948.9417 1,895.87 2 95% 100.33 25.90
129 (F)SLnSTSNKY(H) Chymotrypsin 507.7424 1,013.47 2 95% 46.77

Protein Sequence

misiipkqnrpvgaifslllaltihqtltsnvpttaatpetssppaspvtpgppe[rgny
nvtnandtvcllar
m]alqlnisftstsqgklvqevlnlhpnlvkfsgscesdraslilt
ednitltfs[fSLNSTSNKYh]lsglelsaslpdmakglvvrnttlnylvgtlghsymcq
kektlsvtqnfslntfqlqvqpfgvkgdfgaaeeceldeddmlipivvgaalavlvlivi
layligrnrshagyqti

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University