N-Glycosylated Protein Data

Protein Summary

ID: cathepsin
Protein Name: cathepsin
Protein Symbol:
Protein Function: serine type carboxypeptidase activity, proteolysis
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
193 (K)NSAAnDTGFVDIPSGK(E) Trypsin 797.37 1592.73 2 95% 109.33 25.34

Protein Sequence

hwdqxkkwpskkxhapxxgwrrifwkknlkxiemhnlxhsmgihtyrlgmnhfgdmthee
frqvmngfkhkkdrrfrgslfmepxfievpnkldwrekgyvtpvkdqgecgscwafsttg
alegqmfrktgklvslseqnlvdcsrpegnegcngglmdqafqyvkdqngldseesypyl
gtddqpchfdp[kNSAANDTGFVDIPSGKe]ralmkaiaavgpvsvaidaghesfqfyqs
giyyekecsseeldhgvlavgygfegedvdgkkywivknswsenwgdkgyiymakdrhnh
cgiataasyplv

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University