N-Glycosylated Protein Data

Protein Summary

ID: choline transporter-like protein 2
Protein Name: choline transporter-like protein 2
Protein Symbol: CTL2
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
204 (K)nASIVMEGR(Q) Trypsin 497.2383 992.4621 2 85% 39.24
400 (R)ETCNPEnFTSSSMK(S) Trypsin 824.8263 1,647.64 2 95% 33.44 14.77

Protein Sequence

mdmeekpkygeprkfdpsfkgpiqnrgctdivcciifiiailgylavgilawthgdprkv
iyptdsmgqfcgqgklekqpflfyfnmmkcaspmvllefqcptpqvcvqtcpnrtmtlit
aiskpqdweyyksyckedpghkaaaqilkeklcpaylvssnpflqrcfpsmgkkgevitv
gdqekfsdgvnvldakdlmagm[knasivmegrq]vamkifedytkswywiliclliavv
lslifivllrflagvmvwvmilmvvaviaygiahcsikyvslkdtpgsnitlqqlgfqpd
favylhirqtwlafiiilaileliiillliflrnrirvavelmkeasraigyvmsslvfp
iftffllaiviafwgvnavflstssepvykvfnetecvhs[rETCNPENFTSSSMKs]dc
phsqclfafyggetpyhkylillqfynvflffwcanfvtalgqmtlagafasyywafdks
kdmpafplcaslgrslryhtgslafgslllaivqvirvlleyidhklkgaenkfakfllc
clkccfwclekfikfinrnayimvaiygknfcrsardaffllmrnvvrvvvldkvtdfil
flgkllivglvgifaffffsgqtdafkgtapslhyywvpiltvlvcsyliahgffsvyam
cvdtlflcfledlerndgsaerpylmsenllnvlkkknqan

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University