N-Glycosylated Protein Data

Protein Summary

ID: hexosaminidase-like
Protein Name: hexosaminidase-like
Protein Symbol:
Protein Function: beta-N-acetylhexosaminidase activity; catalytic activity; cation binding; hydrolase activity, hydrolyzing O-glycosyl compounds; carbohydrate metabolic process; cellular component; angiogenesis
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
154 (R)DDYGAYFVnK(T) Trypsin 596.76 1191.51 2 95% 30.02 19.78
435 (R)NSYAVQPQnFSGTEEQKK(L) Trypsin 685.99 2054.96 3 86% 60.25 23.82

Protein Sequence

mariaksprfcccllsvvfvsqfvervcgvwplpqeiqqsaessglspqlftftysqdsa
aqagcsvldtafkryfsiifpdftkdalhdmwlepkafvlsvsvktrgcdgypdedsdes
ynlsvsegqavlrsvtvwgalrglesfsqlvy[rDDYGAYFVNKt]eivdfprfafrgll
ldtsrhylplhailktldamayskfnvfhwhivddpsfpyqsrtfpdlskkgafhpfthi
ytqsdvmrvieharmrgirvvpefdspghtqswgkgqpdlltpcykggkpsgtygpvdpt
vdttyrfmerllkevkfvfpdsyvhlggdevsfacwqsnpsvgkfmekmgfgrdftkles
fymesimnitaalnktsivwqdvfdyheripqgtvleiwkgetyqtelskmtkaghrvll
sapwyinhitygqdw[rNSYAVQPQNFSGTEEQKKl]viggevamwgeyvdatnlnprlw
pracaaaerlwsneektlnadlafprleefrcelvrrgiqaeplfvghckhefngl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University