N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC321166
Protein Name: hypothetical protein LOC321166
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
2869 (K)IDLQNnYTVILNSDEQMLSTGLLAR(F) Trypsin 946.8105 2,837.41 3 95% 92.61 26.61

Protein Sequence

mggtklclllllcaialslakrfksfqkyeytyeteslnalngaingpkarckveievpr
icsyivhttecelsdvidvdaegkpifmssagaeafkaamaknplkftvegdndiklfpe
ndepanilnfkrglisalaapvleedrnrrmptvygmcrtdysvnarqdiatdvvlnrdl
sncdkfspvkdhtsplalitgmqyplaqlirssqtcnykfdndqkhmtsascsekhmllp
fsykgehgvsnvgkqaltlvgvsvyngrifdhneanmktlhlddsidsvhpiqdkdails
ilrdlndlsettngenrahlahklistirkmsaeslsaalpealeisrplvyqalfqcgt
pectsailrvlrtfdrssveidaavyamgmvpnpsrdlveemlemakfksskpiyyalsn
avkrlyeveksvtpeikavadytleqigdctgnqehvylslrvignmaaavgaaspalks
aviqcinqpaaspevqqaaiqvfrltsvpdegrevlmkvifdkaapiqkrvaaylivmkd
pqptelaqlvaalpnnkncqamsfvnshlrnilssttsetgelrvkilnalqgneistst
dptkfsrnykigslegnvifeseellpnevilemtlnafgydvdmfeiglngkgleptvd
aligidgffrdtmqktinyaadkvprgndimqsmfptlwnnikmqkapqsivkeitnnvn
kliqklkvqdnpeamiylrllgaemgylktndvedmaysaalltksllnmfptdflrnly
ssvnnnlflhyvfmdnefylptgtgiplrvalsgtfapgvkgglklardmsevafmpsag
vefvtevgallpeyvesglemhtniyhesglkvkvavtnkqfkltiptpktstklisvsn
slysvtgteikripplaehvkarkctpfipgfqycgvmqysnafsndaapyfpltgdskf
aieihptgevssytatadyaydgkddtvtfglkaegitfesivkltfdrqnyevsadvqi
pdydleagirvhavdrkaqsdathsiqidlmkknvpeasliglakigsmkdamlqvqlli
pnfetdakvtatlkntdelkvelesdiklpemtssiqkmilkydaeeieaevssdvttei
hniittdaikatfndildqeigtsdkkirdvltqfveasnayleqfspnipyvqelripa
lpeftfpkklflnaegaakykfgqnyytitipvplggktsrdfnlpaaletpvlnvpqld
lqvksiniplpvffipeslslslplvakaevssklssnfydmeakasagselvdkptysa
mievtgtspvdllsfkiegstflvgrlgeslktemksslnhklleasvnyfeeittgeki
tmkssskmeakspfglkislehtgqvgldedeisgdgnllgsikagplngevalrqslil
lpfkpelkidsslkvdleqiqaeniieaafangelsftskstafqdnlihvaelaykesq
lalksdarakafglniqnvaeasasfnlvnvkidtnvdtlfgnrvrsqfiaaldangldv
ksdasanldehtashmcslsltrnglvtigstllecpdmpltlqnkfngaldtsglslsv
etkgkfvevtientnslsaslssvdfiskansddgtyvhdfslqlqpystslkisnnlna
lniklineaqfkalpyaadltgswklssgtdelkntyeikyedlvatakcgltgklmgsh
msqnteievaglsvtygsesnfnsqylrfnsdlhaaavpfrfnvdamvnadgdlylygkq
saqvyskflmkaeplafahshecrvsttynlyddlvfetnldnkidtvltpseqkatvrv
kskfnnhefnkdlsayntperlgvemsgsiitnifntvdsdnqdhffsaflkydknsnsr
alslpfidefpfdlqhmklavlriveamqsyinreeiiveiqklatyvsdfvnelnleek
iikfskdltalyedygitlddleaslmnlkpvllklvteldtyvveiekivrEIITSGTP
SDAAIQRftdilnsfnekydvkaivltvieaiekflreidvmsikgsrevfkqyvdeyfa
ikskveeilselkqfvanfdqekftedvknfvtsarfrdyadnlvakipteqiskileka
kqllnllgnrmnaiytnvreilvksgvdkkietllkkvvelikkfnieetvktladtlks
iltpvtelvdkainylktteakeiiedlnnclnhcikyirsfdynafvdeanqkikkltn
dlytmslsleirqkleairEFVNYALSSMSACIEKlekvkvvdvvkkfsdivdsvvfidt
ealiedlrkiladidireeiqkflkHASSISTKvvttatdacsavmqviqnilkdqavvn
elkqicdrvktvlrtaefkipsfifpltdlvvpsikislknlqeinlpsslidlpgftil
qyytvppirveyadikqglldllhfianfeimpavenifgdlrivympdisaitlpeisl
peislpeipkyiskhkfsdltipeftlpgvptevmvpcfgklygevrvtipifnmrttve
flnstesaetpqfvghitshgsseydllkytldstarvampkmsrvilaetlkithsvla
idhqssvslyglsaqasskstmkitsstynanivntaffalaggisanikttyndklnad
lwnseyyygndiilkqdglkllltmeeeakghisvleksdditgkssssiiitpttfsli
isvdssssvsnikksikadgvalsyvdftasiegtsdselfllnaagkadlrqmkvemka
dldtkyagllsgtftsafnflvqpfevvldfknkantklnlveplsa[kIDLQNNYTVIL
NSDEQMLSTGLLAR
f]nqykyshnftlannedeagiyaavngeanlefltipfsipamel
etltmvieipeisninlyeqtglkhvltdfdqaidvdakmvyqkndltselsfkssifnl
nanagfyqkdnpvirfgvitasefeslkaklegtsslstksgfklanslllenrhiegth
estatmnlnnfevtlsmatdakmnlpiltananhqltadnkanpkadstfkmdynfdvpi
iklvgkgnaetilkgegtrtfisaetliksnidgtfldrgilkgtlnydeslyvngnslr
yalktggngdlnygdfkvafdvdenlsvetanehvyatmkftsnneanvgsfntkgvhss
qatldmallkslvadmkidlsqpstfgelsifetmkvdlsapkqkidilstikspvyttd
vrakldgnapdyktvlkasatspvvrlqydldssmsstmengalvvganavlthqdftmd
isnairmsershilnvditsqtftdvnlryaarsdgisgsvstpgsgllgfqlqgnipsq
mnarlycryafapdddvdilsvravpkgdekvllvtgnikaaqsmfeglmntlekisfkl
aglareyglafpifvaddvygvisnglsaarratpgvselsqlfrnvvvtsqktiqvlid
naivlvkeisqyklpgmneatlaeickkiqlvvvemlrnfgnnlevyfspimdnfntiql
tfpngkvmtvaefqqnvqsilrsnlvmiadamkqiespdvvlkklgqtlqevvekgqefv
dkmnlsllediaaaintfyqelmkiiediseavifgfsipaikiyeisqnigkvlnanng
ihqfelplpffq

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University