N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC322814
Protein Name: hypothetical protein LOC322814
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
421 (R)ETTLLVGnQSSR(F) Trypsin 653.3369 1,304.66 2 83% 38.51

Protein Sequence

miensmfeeepdvvdlakespsyhidsddvtyeprssrllvrglgendmdedeedyessa
rllgmsfmnrsssqrsaassytrqqpsnscsplstkttavgvlilvlvvsmfmviyfvps
ctftkkgcqksnssmssiypistsgelfpwtdlrlpvsvhpvhynislhpdlnsmtfqgn
vsivvlvvhetknivlhssdmniikvtfddkeyrfleykpwqqiaikfpedlkkgqyvlk
fsykanlsnsydgfynssyvdtagtkrvlaatqfeplaarkafpcfdepafkstfvvkmt
reakyislsnmpkikttdlnenglqedefessvkmstylvafivaefsshsknvskttvs
vyavpdkkdqvhyaletackllkfyntffeieyplskldlvaipdflagamenwglitf[
rETTLLVGNQSSRf]dkqlvtsviahelahqwfgnlvtmrwwndlwlnegfatymqymsi
envfpdldidieflnvrfkalakdalnsshpvstfvstpeqveemfdsvsyekgasillm
lnatlrdgefhkgvieylqnynlsnteskdlwnslsqvskqslnvsemmntwtvhkgfpl
vtvkrngpqvtlsqehfllnaengtddsslwhipltyvndscsvlrsckqvfhlkdkeat
lqlpgqvkwlkfnfrsdgfyivhydeqgwsdlisalkvdvnvlpsedkaalinnifalsr
lgkvsfrqvlnlmdyirnetetapltealsqlgqiyrlldkrsdlnlassmttyieshfg
slmesqswevetsvskmtlrsalletacalnrpncttqarrlfdqwlasnktlqipsdlm
rtvfkvaaktdegwskllgsykhsiydtekrkmlealastqdvrkiiwvlqksldgseiq
nqefplvihtvcrdfagylyawdfmkenwekitqkfpigsfaiqsiitsttsqfstkthl
aevqnffsslgakgsqmrivqeaietikhnmrwmeknlntlqswl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University