N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC324985
Protein Name: hypothetical protein LOC324985
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
143 (R)LnSTYR(C) Trypsin 377.69 753.37 2 62% 21.32 18.57
362 (R)LQLQPFnITANR(F) Trypsin 708.39 1414.76 2 95% 58.88 24.23

Protein Sequence

maraagvcwtllmgcvfaahavtfevtdgnstcikgelnasfsisynttngtsvsvfalp
asasvsersscgsaavppelalvfgdththtlsllfsrdqrlyrvsnislqynlsdgdif
pqsssagvqsvmasvselmsa[rlnstyrc]vssssislsaavnltlsgvqmeaymssan
lsadesvcsadqpsttvapppstttspppippvpergnysvtdgngtvcvlalmglqlni
thtttqnqsvselmnlqpnqttvsgscgvtesslrlsdettnltfsftmnsttqkyylsa
vsvsalwpdmsvvfeagntslsalqcsvgrsyvcsaqqmlsvtpvfsintf[rLQLQPFN
ITANR
f]staeecrvdqenmlipiivgaalaglvlivlvayligrkrthagyqti

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University