N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC336746
Protein Name: hypothetical protein LOC336746
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
348 (K)MFnLTGQEYVMK(M) Trypsin 747.34 1492.66 2 95% 56.79 22.92

Protein Sequence

mngfhlfafliglliadsqaiiriplhkmrtvrrmladngktideikslakmkakysdgt
ftnqgsvtipaptttqlpppvekltnfmdaqyygmisigtppqdfsvlfdtgssnlwvps
ihcafldiacwlhrrynskksstyvqngtefsiqygrgslsgfisqdtvnlaglnvtgqq
faeavkqpgivfavarfdgvlgmaypaisvdrvtpvfdtamaakilpqnifsfyinrdpa
gdvggelmlggfdqqyfngdlhyvnvtrkaywqikmdevqvgstltlcksgcqaivdtgt
smitgpvqevralqkaigaipllmgeywidckkiptlpvvsfslgg[kMFNLTGQEYVMK
m]shmgmnvclsgfmamdipppagplwilgdvfigryytvfdrdqdrvgfapak

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University