N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC393175
Protein Name: hypothetical protein LOC393175
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
190 (K)AnFSVQIR(R) Trypsin 468.2527 934.4908 2 66% 34.21

Protein Sequence

mtrlpvllnlivlpihlwaavtpeptslpisssgepfpwnkmrlpdtiyplhynllihpn
ltsldftgsvqiqievlqdtktvilhsknlqissarlldaniaqqqplkvleypyfqqia
lvsdkallkrghvysvelhfaanlsesfhgfykstyrtskgdvrvvastqfeatsaraaf
pcfdepaf[kANFSVQIRr]eakhialsnmpklrtlelknslfedqfdvsvkmstylvay
ivsdflsisktsqhgvqisvyavpekidqaefaldaavklldfyddyfdipyplpkqdla
aipdfqsgamenwglttyresallfdphkssasdklgitililnvriwrktncmltvmll
vipinmrgwktphhllksqi

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University