N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC393213
Protein Name: hypothetical protein LOC393213
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
121 (R)TTnGSGPLNK(L) Trypsin 495.25 988.48 2 95% 30.28 24.52

Protein Sequence

mlqlgdglvlfstvfvvvlvgtrsavwptvlaaslylflvmfrfpqvpssrtrqvlqpgs
rvpaggvsavahrggghdapentiaairaasengatgveldleftadgvpilmhdetvd[
rTTNGSGPLNKl]lfselrkldaaakhrfsdrfrgekvptlqeaveecikhqltiyfdvk
ghpdeaaaalkelfrkypvlyntsivcsfepkviyrmrqadpnvvtalthrpwslsrfgd
gtprfsstwkqhwmqvldvlldwahhhllwnlcgvsaflvqknfispdyvqywaargvev
vgwtvntavekqyyqqllkinyitdslvedcdphy

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University