N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC393249
Protein Name: hypothetical protein LOC393249
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
105 (K)ENLQLnISSSAK(A) Trypsin 652.84 1303.66 2 95% 54.45 26.50

Protein Sequence

mmgalgngrrggrspsllmaaliscilllafnywvsnsrnvelqskileledhirllsad
rereeksklkaedemhrqneqlelmekthhrqqenainswrqe[kENLQLNISSSAKa]v
qnmknrmkslledvnkmqselkschssmdtltkkansdktqcnkeieatkeecsvkiaaa
kqeklktaekvdpqdadgpeqkvlkaksdvlasnnlnknpaeppngkldvdspsnldaqv
etnelvvekdakdavilqdtpiaaskltnksetlkkpafeavaeavedikepapkdaeav
ldeadilepkeneagigdaneeddvgigdanqeeddedlklkagdlkeedaavgkedaim
ydnegeiekqlsqikdenqgagqdleddvanyngddenqpesedekqaelagm

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University