N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC393392
Protein Name: hypothetical protein LOC393392
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
282 (R)InTTSDER(D) Trypsin 468.72 935.42 2 95% 45.37 22.28

Protein Sequence

mrlsvmsvfpvlpvllgllcasgpargyygnplnkyirhyeglsydtemlhsdhqrakra
athtertlqlefhahgrhfnlrmrrdtglfaddfklevsgqemdydtshiysgeiygeqg
tlthgsvqdgrfegfilthrgtfyvepverylqdknvpfhsviyheddidyphkygpagg
cadasvfqkmkryqstahqeptdsppaqdedvllrkkrmtqvekntcqlfiqtdhlfyky
yktreaviaqisshvkaidaiyqgtdfmgirnisfmvkri[rINTTSDERd]rsnpfrfa
nigvekflelnseqnhddyclayvftdrdfddgvlglawvgapagssggiceknklysdg
kkkslntgiitvqnyashvppkvshitfahevghnfgsphdsgsectpgeskspdkkerg
nyimyaratsgdklnnnkfsvcsiknisqvlekkrgscfvesgqpicgnglvepgeqcdc
gysdqckddccydanqpdnkkcklkpgkvcspsqgpcctfecsykghnekcreesecahq
glcsgssaqcptsepkanftachgntqvclnggcsgsicekyglevctcasvegkdetel
chvccmekmnpstcsstgserlsrffgkrvitlqagspcndfkgycdvfmkcrlvdadgp
larlkkaifnpelyeniaewmmahwwavllmgialimlmagfikicsvhtpssnpklppp
kplpgtlkrrraqhssqhpppshqqavphahalpnprpaprpqparhhrsarenyqmgqm
rr

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University