N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC399488
Protein Name: hypothetical protein LOC399488
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
273 (K)VLIGVTDQSSPEEISATLnK(T) Trypsin 1051.55 2101.08 2 95% 120.43 26.28
310 (R)EVAQAVESLYSTYnQTR(L) Trypsin 653.98 1958.93 3 95% 89.5 26.03

Protein Sequence

msndtevdmkdvelneveqekqpmtegdagnnyaispvtekngivkvkipdeeskftgls
keelmkvagtpgwvrvrwallilfwlgwlgmlagaiaiiiqaprckplpemnwrnngply
qigdvgaftnssdikdlagkvqalddlkvkgliigpihvssedkpnelnlikiseddgvl
aqfkevitaahkrgisvildltpnykgkdpwfsdavntvqkvepalifwlkqgvdgflfy
gvekvaaaaptfwsdvvalihnqtdaegktk[kVLIGVTDQSSPEEISATLNKt]gvdll
lsgalrsksv[revaqaveslystynqtrl]awniggriaghlasvvgfakvklsqlmll
tlpgtpvfnygdeigledevnkyptmlwkfndeekqkemstyhsffksvsvkrmkerslq
hgeylplfisdfamayvrswdqnerylialnwhsnetvslqlkhadipesatvvfstsge
tevnkelnlaqlevnpgegimlkfpyts

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University