N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC404631
Protein Name: hypothetical protein LOC404631
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
505 (R)IYSnGSDLSVER(V) Trypsin 670.8217 1,339.63 2 95% 48.49

Protein Sequence

maprwivifvavlcvlqvyvcrevtlpagplyrvagfslslpcavsayegprtqdfewyl
yredaggrqigvvstrdtgfpyapfqsrvqsgevrverdsgdkarliiqrlraddqgrye
cytpstdtrflgnysssvtvkvipdtlqithsrilsgqpviegtelqltcaasvqsqqht
hvsvtfgvrssretesqghnlreiisidrelrvtpghsggfakrhrdgeitlekrkgdrg
qdlytlkisaltpedsgsyfweaaqwirdpdgkwerialrtmelgnltvqpladsltvrs
vpegvvslqpgaplslscvvsglgswnrsallvqwmrrglaggvevelarvgpdgvvlwg
ddasragggsmereadgkfslrlfsvhpadaglyrcavsvyagrktpgpaspatvtqrsd
wvtvslkteevrvsavidlprrpllkrgstvsifcnvsvwsrtpaqvalewrhtpedplq
kdrsvsadskgrvlavltrdglt[rIYSNGSDLSVERv]seicyrlrvfsadqpdqglyq
ceaqvwaqdprggwydtgvraesttarlylyarvtdllliplvvgvssalfvgvliiatv
tccfmkrlarqrsrvrk

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University