N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC407979
Protein Name: hypothetical protein LOC407979
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
360 (R)DLQGNPISnASVSVEGIDHDITTAK(D) Trypsin 861.42 2581.25 3 65% 21.78 27.36

Protein Sequence

mraavfcgavlmlalssvkeaegengisfeyhryeemrkslvsvwlqcpsitriytvges
fegrellvlemsdnpgihepgepefkyignmhgneavgrelliylaqylcneyqegndti
idlihstrihimpsmnpdgfekaasqpgemkdwfvgrsnaqgidlnrnfpdldrivymne
reggannhllknmkkavdentklapetkavihwimdipfvlsanlhggdvvanypydetr
sgstheysaspddlvfkslakaysiynpvmsdtnrppcrkndddssfkegitnggawysv
pggmqdfnylssncfeitlelscdkfppedslkqywdqnrnslvnyieqvhrgvsgfv[r
DLQGNPISNASVSVEGIDHDITTAK
d]gdywrllapgnykvsasapgyltvvkkvavphs
pstrldfelesleerkeeekeelmdwwkmmsetlnf

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University