N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC415149
Protein Name: hypothetical protein LOC415149
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
87 (K)AGVFDnATDLR(W) Trypsin 590.29 1178.56 2 95% 84.65 25.50
98 (R)WLVLDNNnITSDK(I) Trypsin 766.88 1531.75 2 95% 71.69 25.87
153 (K)LTSFPANTLAGMEnLTTVHLSK(N) Trypsin 788.07 2361.19 2 95% 84.59 26.98
317 (R)LDGNnITHSSMPDDTANCLR(Q) Trypsin 749.99 2246.95 2 95% 59.6 21.46

Protein Sequence

mfalgsillagllslslaqydyydeyyipsaplegvsspscaqececpinfptamycner
nlkfipivptgikylylqnnfieei[kAGVFDNATDLRWLVLDNNNITSDKi]qagtidk
lgslekllfshnkltkppgslsksldelklign[kLTSFPANTLAGMENLTTVHLSKn]k
lttesltgafkglkslilldvsenklkklpsgvpasllmlyadnndidsipngylaklpl
lqylrishnklvdsgvpagvfnvsslleldlsfnklktipeineslehlylqvneinkfe
ltnicrfsspvnysrlrtl[rLDGNNITHSSMPDDTANCLRq]aseiife

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University