N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC436653
Protein Name: hypothetical protein LOC436653
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
88 (K)LVnVSLPK(K) Trypsin 435.77 869.52 2 82% 22.26 18.33

Protein Sequence

mfpktsftslivgvfllyvlhtcwvmygivytkpcekrraescispylaakprlqlsvyt
alrpnadgghslihreeefdvntkfe[kLVNVSLPKk]trkngtlyamvflhqagvspwq
dphqvhlvtqlttymlpkppeislitgqdepekpdqqkqssdseldrpvshwrsrltlnv
vsenflfdrealpgdvhrymrvyqsgkkmiylpllfvdelsnrvkdlmeinssstelplt
itydsialgklrfwihmqdavyslqqfgftekdadeikgifvdtnlyflaltffvaafhl
lfdflafkndisfwkhkksmvgmsskavlwrcfstiviflylldeqtsllvlvpagigsl
ievwkvkkafkihviwrgltptflfgkldesekrteeydtlamkylsyllyplcvggavy
alvfvkykswyswiinslvngvyafgflfmlpqlfvnyklksvahlpwkafmykafntfi
ddvfafiitmptshrlacfrddvvflvylyqrwlypvdrsrvneygvsydekpkgkshed

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University