N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC445125
Protein Name: hypothetical protein LOC445125
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
143 (K)ISnVTCDASIAK(M) Trypsin 640.31 1278.61 2 95% 54.86 25.20
245 (K)NEnDTLVNYAVNPVVR(E) Trypsin 909.45 1816.89 2 95% 97.55 26.79

Protein Sequence

mgllkvsvvfllslitmtlaeppgckiritkkglemlkaetkkfveeelsnitmpemqgs
egrfqytinnvriielnlasdlrfqpdvgllfevqnssitlnfqrrilywlfydegaina
saegvniftvlhlskddegrl[kisnvtcdasiakm]rakfsgtlgrvydfigtflttgm
rfllnkricpvlnhaalvsvnqlletipvraqvdsyigidysllsdpvvtetsldmdfrg
mfydl[kNENDTLVNYAVNPVVRe]ydrmiylalseyffdsglysyfkgglfqlqianer
mpkdlevllrttylgtimmlnpalmdqplslefevtapprstiktsgasvavncnvkvlv
lpagkpavqlssmtmegkfnakvsmkgkrlaihldlrrfkifsnqsaleslaliplqgpl
ktmlqisvvplinnytkrgvqiplpdgidfieevveyhngyiivganlhfqtglremieg
klvgesdnsi

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University