N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC447841
Protein Name: hypothetical protein LOC447841
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
207 (L)HNAnSSQL(R) Chymotrypsin 436.2007 870.3869 2 89% 38.1

Protein Sequence

msmfkvslicslllvvfgaargflgrgdafrrkvsvelnpglapplslppgvglvhlrgl
gdndtlhfvlcnagapalllvhsnstrsavtvdwpefinsssagslrvepessvtyssal
vftrlweyddvnntadpqkaaessfyppyelqnfvwselnttlnqsehtvvlcggektqs
fsngslclqvsvfesqgrdeawpsl[lHNANSSQLr]vwingvtprgnnsrfilefqsvg
dagfqsrvdmrssiddeytpsifkvsewvsspvnsssvwgfsqwkpvayrkarpvfedat
acrhselvfvngtppsaviqayfthntriyglnisfglaedpvfydatkyiswtvlmglg
dppsdsfspliiiiitvglvtplvfiilggvfvcvrkrtsqstayepin

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University