N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC449691
Protein Name: hypothetical protein LOC449691
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
126 (R)LYLNNNnLTEVPSNLPR(S) Trypsin 986.5198 1,971.03 2 95% 96.73 26.24

Protein Sequence

mrliallllglmevslaqdpfqwlsslhsrgyaslqadntggecpeecdcpptfpiamyc
dnrniqkmpyipsrmkyvylqhnqitsvpdnafgnatnlvwvmlhenhinsvgkqafakl
snln[rLYLNNNNLTEVPSNLPRs]lrdlrlnhnkigklapnafegmenltilllhhnsl
qdigvglkglksltlldvsrnqlkkvpeslpemlhqlyldsnsigavpanflnqfsnlqy
vrfahneltnkgipqntfnnsglveldlsfnklesipvvstslqhlylqanqikeftlgs
fcsvvdvmnfsrlrvlrlegneigagdvpseaalclrlasdiav

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University