N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC492466
Protein Name: hypothetical protein LOC492466
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
178 (R)ELFnTSLK(S) Trypsin 476.75 951.49 2 94% 26.47 22.92

Protein Sequence

mtvrrvnvvilvllvvaflivlhrnllnlndflnqetsdtvpgmilpfetdfllgrkamr
sgeeipvlitapeerlgaavtamnsiyrnskanvvfnivtlnesvvhlstwlsktdlkhk
iivfdpsillgkiptdaqkmetvrpltfarfympaflpdaekaiyldddvivqgdi[rEL
FNTSLK
s]ghvaafsedcdsasskgivrgagnqnsyigyldfkkeaikklgmrantcsfn
pgvfvanltewkqqnvtsqlefwmernakedlysktladcmttppmlivfykhhsnidpm
wnvrhlgatgagnrysaqfvkaakllhwnghykpwgrtssfsdiwdkwyipdptgkfhpi
rkhveek

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University