N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC541367
Protein Name: hypothetical protein LOC541367
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
149 (R)VPNFGGnVTLR(E) Trypsin 587.81 1173.61 2 95% 48.14 25.17

Protein Sequence

mlvgygldqrvcrdggwdgrdpecevvkcaappsiengqlsdeplesyeysqvvtyrcns
gfslsgssnlhcsddgtfkpdppkcldgcpkpeiphairiggrsppykighfieykcedl
ytlkgikeiacraggwdpeppkciepc[rVPNFGGNVTLRe]efsskdlfphgdkvafkc
ksgyepvdstvsriatceetkwtkllltckeeksssssaplgailggifgsggllllgcf
gvymlvtkqskrkqkvptneegsl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University