N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC541416
Protein Name: hypothetical protein LOC541416
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
97 (R)GGLPLnETTIAEVLK(T) Trypsin 778.4348 1,554.86 2 95% 79.36

Protein Sequence

mriialcaliaahcvgasppnfvllfaddlgygdlgcfghpcsltpnldrlaanglrftd
fyvtspvcspsraalltgryqtrsgiypgvlypgs[rGGLPLNETTIAEVLKt]qgysta
ivgkwhlgvglngtylptrhgfdsylgipyshdqgpcqnlscfppdvkcfglcdqgvvtv
pllfneiikqqpadflqlekaygefasqfisdsvkdnrpfflyypshhthypqyagadya
gksprgpfgdalmefdgtvgkilqtleetgvinntlifftgdsgpelmrksrggnaglmk
cgkgttyeggmrepaiahwpgfikpgvtralassldilptfaklagaplpevqldgvemt
dilfnlgpskrqtmfyyptdpsvkygvfavrwenfkahyytrgaahsestpdnscsllaf
lkyhdppllfnletdpsenynldgdqwdavrkqiqavkqqfeasmvfgesqiskgidsll
epccipncrpkpeccrcnsal

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University