N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC550326
Protein Name: hypothetical protein LOC550326
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
140 (K)nVTTVGHK(K) Trypsin 428.73 855.45 2 95% 31.47 21.07
430 (K)SSMVAQLTGYTnVTSGDILALK(A) Trypsin 1143.58 2285.15 2 95% 130.29 26.30

Protein Sequence

mwfllagfvllcaadatpvaertvpefgktyhvkgllslpyaeikepfeawydltgkrsr
idyyhgqvctffvgndldygavykitpvttetefntmkcfqlngtkdepiipqialpdvq
gfefekieyyagvlcevw[knvttvghk]kntyrlwvtrpegidssamphhyemmgfntl
lgshydkyivdysdfssqvdpnifklpggmscggfpgpgvehhllanpiqdfvetspvsh
ahrmfghykekfnrqydnemeheerehnfvhniryvhsmnraglsfslsvnhladrsqke
lsmmrgcqrthkvhrkaqpfpseirsiatpnsvdwrlygavtpvkdqavcgscwsfattg
tlegalflktgqltslsqqmlvdctwgfgnngcdggeewrafewimkhggistaesygay
mgmnglchyd[kSSMVAQLTGYTNVTSGDILALKa]aifkfgpvavsidaahrsfafysn
gvyyepeckngindldhavlavgygimnnesywlvknswssywgndgyilmsmkdnncgv
atdaiyatla

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University