N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC554458
Protein Name: hypothetical protein LOC554458
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
286 (R)LNQnSSNPNEVSIK(V) Trypsin 772.8812 1,543.75 2 95% 76.33 25.02

Protein Sequence

mssavsniikhpnynsdtednditllqlastvsfsnyirpiclaasdstffngtlvwitg
wgntatgvslpspgtlqevqvpivgnrkcnclygvskitdnmvcagllqggkdscqgdsg
gpmvskqgsvwiqsgivsfgtgcaqpnfpgvytrvskyqswiqqritttqpgfvmynsng
tdgdlsvncpglptippttasttqtttmstttvapvvcgsaklnsgaggnsllaspgmwp
wiasvqfngshvcggaliaeqfvmtsascfpnstnatgwtvvlg[rLNQNSSNPNEVSIK
v]anfsmsnnsgdnvavlqlavtpnftnyiqpicvdlggnnvdantqcwaagwgsgaggv
nqtlqqyqtsivscgnsssnnsicttafdlqqgvqggplmclvgqswihiavltisnsns
nssisnstlnnstlnnctvnnstvnnctvnnstvnnstannstsstgskgadlyfpvraq
gvqiftktssfstfltavissfpqkatnttsastsapsastsnttqsngspasfsscytv
svffsslltlqifhksif

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University