N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC554550
Protein Name: hypothetical protein LOC554550
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
292 (K)LnSTSMALSLPR(T) Trypsin 653.84 1305.66 2 95% 66.65 25.75

Protein Sequence

mqpifpvpllflllaqqsvwsstpqepkvqgsppeisslhhptwslglqlyrslrtngsq
tntfipplllansllalgggakgstvsqfhdllritknenvvgetlttaqkavhesngts
yilrsssalfskqapeleksfleklqthfgmqhvaledaqkqsdmeklqywaksgmdgee
taalktalefkagamilanalhfkglwdrgfyhenqdvrsflgtkytkvpmmhrsgvyrh
yedmenmvqvlelglwegkasivlllpfhveslarldrlltldrlekwfg[kLNSTSMAL
SLPR
t]kmssavnlqkqlaamglvdawnetsadfstlsslgqgklhlgavlhwttlelap
esgskddvlededvkkpkifyadhsfiilvrdnstgallmigaldhtdgpaihdel

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University