N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC556537
Protein Name: hypothetical protein LOC556537
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
971 (K)YQPInTTEEAGLLK(E) Trypsin 789.41 1576.8 2 95% 51.3 26.77
985 (K)EVLLPAnETSYTLDK(L) Trypsin 847.43 1692.85 2 95% 66.8 26.38
1092 (K)TEFVnGTR(T) Trypsin 462.73 923.44 2 95% 40.98 22.81

Protein Sequence

mdgkrscslcggammimmmmmmishmtsalevpldlpqpptitnqspkdyiidprenini
fceakgkphpsfswtrngthfdvekdpkvvmmpgtgnlvidisgekaevyegvyqciarn
ehgsavsnnivirqsrsplwskeknepitvqrgtslilqcrppaglpppiifwmdnnfqr
lpqnsrvsqalngdlyfsnvimedtrndyicyarfphtqtiqqkqpitvkvldieamndt
vlaaflngsdfwgdspsgervpsflhppgmesttmvlkgdtleleciadglptpniswtk
vngelpsgrfsfysfqktlkikevteadggdyrciaknrmgssqhtitvvvraapfwisa
pqnlilapketgnltcdvdgnpkptitwsvngnpiesshndpsrkvsdgvitlsdvqtgs
savyqcnasndygyllanafvsvlaepprvltslnheysvisnsralldcasfgsplpki
twfkdsqsilnsdlyhihkngtleinvaqpqnsgkytciasnnlgnkenhvhlqvkeptr
iirqpeykevqrnsiavfeckvkhdptlipsmiwlkdngelpddprfevgsdsltihdvt
eddegtytcirnttldqdsasatltvveqpdpptdleltdqrersvrltwtpgdehnspi
klfliqyedslhepgvwlnmtevsgtsttaqlelspyvyysfrvlalngvglsessdpsr
qyrtnpakpdvnpsdvevsgtspdtmtiswrelsglesngpglqykvswrmkdaeqwttv
tlanvsqhvvtgtptftlyevtvqavndygegprpevvlgysgensptvapenvkvsvqs
gteaevhweavplssvrgrlkgykvtyqkmrslhkqdydrenpqvlifsgeetvgrlpdl
hpyshyrlnirafnghgdgpsstdqqfqtpegvpgpptnvnirnlnldsllvewtppled
nghltgyll[kYQPINTTEEAGLLKEVLLPANETSYTLDKl]thsthykfflnamtetgs
gpavtkeaftevdealirhpaveagkappagpmfgnvnssvkedhavisweylgpdgnvy
veyvvdnskepw[ktefvngtrt]fqirglkpgmsyrvrlvakdhsdatihstqemlitv
pamtnrqaeiatqgwfiglmcaiallilvllivcfikrnkggkypvkekedahqdpeiqp
mkeddgtfgeysdtedhkplkgsrtpsngtvkkddsddslvdygeggdgqfnedgsfigq
ysgkkekdtaegnesseapspvnamnsfv

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University