N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC562774
Protein Name: hypothetical protein LOC562774
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
109 (K)DMSDGFISnLTIQR(Q) Trypsin 807.38 1612.74 2 95% 117.47 24.84

Protein Sequence

mmgvrsvccfllisllksssahsdfftsighmtdllftekdlvtslkdyikaeeskleqv
kqwaekldaltatavqdpegflghpvnafklmkrlntewgevedlvl[kDMSDGFISNLT
IQR
q]yfpndedqngaakallrlqdtykldtqtissgdlpgvntglpykstltvedcfel
gkiaysdadyyhtelwmaqalkqldegeessveiataldylsysvyqqgeleraleytkr
lltvdgkkeylpekrkyeklcrgeglkmtprrqkhlfcryfngnrhpfytigpvkqedew
drpriiryheiiteqeiekikelskprlrratisnpitgvletahyriskrratvhdpqt
gklttaqyrvsksawlaayehpvvdrinqrieditglnvktaeelqvanygvggqyephf
dfgrkdepdafkelgtgnriatwlfymsdvaaggatvfpevgaavkplkgtavfwynlfp
sgegdystrhaacpvlvgnkwvsnkwihergqefrrpcglketd

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University