N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC563738
Protein Name: hypothetical protein LOC563738
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
122 (K)VQSYnCSVQQVTAR(A) Trypsin 820.89 1639.76 2 95% 89.22 25.65

Protein Sequence

mwmrpfllvlsvcvfwqdgstnqmpdkcqdaavmkaaeealeqinaerqegyiltlnriy
nvklhkkadginhlhltldvlatqchvisrrkwkscavkdignlpafgtceasvslesti
[kVQSYNCSVQQVTARa]ileacpdcptaerlddpvisettqmalrkynkestsphlftl
vnitaasmqwvvgpsyfvefivqesecrrnsseidltqcppkdsqsalkgfcsgshitad
dtleikvlvdvkceifqpvvsalq

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University