N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC566506
Protein Name: hypothetical protein LOC566506
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
167 (K)YYnYTLSVnGR(A) Trypsin 676.3149 1,350.62 2 95% 62.62

Protein Sequence

mvsaplvllhciivicvtlhcvnlaaaktnpkpnivliltddldvsiggmiplvktkkli
gdagitftnafvasplccpsrasiltgkyphnhhvvnntlegncsstawqkgqepdafpa
flqkhaayqtffagkylneygskkaggvehvplgwdhwfalerns[kYYNYTLSVNGRa]
qrhgqnysedyltdvlanvsidflenksnrrpffmmvstpaphspwtaapqydssfpdlk
aprdpnfnihgkdkhwlirqaktpmsnasvefldnayrkrwrtllsvddlveklvrkldi
rgelsntyviftsdngyhtgqfslpmdkrqlyefdirvpllvrgpnikpnqtsplpianv
dlgptildiagynvndtqmdgmsflpimvgelnssvwrsdvlveyegegrnvsdpacpll
gpgvsecfpdcvcedaynntyacvrtvspnanlqycefddnevfvevynltsdpfqlsni
aksidqevlekmnhrlmmlqscsgrscrtpgvydsrfrfdprfmfsslvphrnkrrqmlk

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University