N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC568615
Protein Name: hypothetical protein LOC568615
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
584 (K)GSQIFNEnETYPR(A) Trypsin 778.35 1554.69 2 95% 66.78 23.89

Protein Sequence

mnsakksclvlivalavtlevtagevpsddgvgeggdsqstaeneganivtgrayvpkda
qtdssttdtdmeikvdeiekedlpsqppppqerskevpvvnggtasgepcifpflfqgke
ysdcttegrgdgrlwcattydynndkrwgfceteeqaeqrrmaeeaeeqyqatvrmingt
nrrsqkkelfdkllqvaemghtkamekvayamlfgdylpqsipqakemfeklalegspka
qtalgflyaaglgvnssqakalvyytfgalggnlvahmilgyrywggvgvpqscesalth
yrlvanhvasdvsltggsavqrirlldevenpgsssgmleedliqyyqflaekgdvqaqv
glgqlhlhggrgveqnhqrayeyfnqaanagnthamaflgkmysegseyvpqnnetalhy
fkkaadlgnpvgqsglgmaylygrgvpvnydlalkyfqkaaeqgwvdgqlqlgtmyyngi
gvkrdykqalkffnlasqaghilafynlaqmhatgtgvmrschtavelfknvcergrwse
rlmaayrsfkegdmdsaliqylllaeqgyevaqsnvafvldq[kGSQIFNENETYPRa]l
lhwtraaaqgytvariklgdyhfygygtdvdyetavihyrlaseqqhsaqamfnlgymhe
kglgikqdihlakrfydmaaeaspdaqvpvflalcklglvyalqylqdlnlkevlsqvdl
dqllgpewdlylmtvialllgtviayrqrqhqavprapaapnrppaqpeqpaeepeeq

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University