N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC619255
Protein Name: hypothetical protein LOC619255
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
75 (K)VEMIDIGTQTLAnGSSIDLPK(V) Trypsin 1110.06 2218.11 2 95% 113.23 27.15

Protein Sequence

misisvfclllctgasafrfeeltqyvnthqdefvetlrqwiavesdssdvtkradlhrm
mdmtaeklrligg[kVEMIDIGTQTLANGSSIDLPKv]vtaqfgddpskhtvcvyghvdv
qpakmedgwstepyeltdlngnlygrgasdnkapveawihalevykalnidlpepfrtsq
ekassccpseasttactprtrrsadattlkepnsssrtctkcprsrsteealqtnthmss
vmqipd

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University