N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC641570
Protein Name: hypothetical protein LOC641570
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
234 (K)SFVQTAFGnNTEIIPAGGAGYK(A) Trypsin 1,122.05 2,242.09 2 95% 78.17 26.96

Protein Sequence

mapmgirlsplgiavfcllgvgviyhlyagvlssrlaffrqkrtvdlrellalsidaavq
ggrevkriredntleekskgktkegasekytlgdlnshrkmyylikntfpniqvnseeha
naegeatvwtrmipedilakvsggkeipaekitvwidpldatqeytenllkyvttmvcva
vdgepvigvihkpftgytvwgfvgegsnvaprdsyntnspkvivsrshagkv[kSFVQTA
FGNNTEIIPAGGAGYK
a]lallnptddkqetadiyihvtyikkwdicagdailkslggqm
ttlkgeqidysglegnkggllasmkvdhkalvkrlplwednkq

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University