N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC678538
Protein Name: hypothetical protein LOC678538
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
32 (R)TnTSYVK(L) Trypsin 407.2041 812.3937 2 95% 48.56

Protein Sequence

msllflcllsltpavategglsgkvllfta[rTNTSYVKl]ipdkhlslsaftlcmrvat
ellgfrevilfayrtpevdelnlwrekdgrfsvyiqssgdgallrlpplsifqthlcvtw
esatgltafwvngrrslyqvyrkgysirpggtvllgqdpdsyvgsfdvdqsfegeitdlq
mwdyvlsgtqikavysnqephvngnvfnwntikydavgnmilvhdn

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University