N-Glycosylated Protein Data

Protein Summary

ID: hypothetical protein LOC798421
Protein Name: hypothetical protein LOC798421
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
125 (R)HAnQTVAGIDK(L) Trypsin 577.7964 1,153.58 2 95% 64.39

Protein Sequence

maavvnysppwwvnlfhrlphfnlqfqqtssdfrpddsdyqkavlllgaaalvclaldll
fllfysfwlcccrrknhdspnadccctawcviiatlvcsagiavgfygngetcdgvtrlt
ysl[rHANQTVAGIDKl]vsestsslnetlmeglvqletvyskqtdylsivqklqgqlde
linlmlgvpfwssndlsldhlasiteqydwyrwlgylglllfdviicllvlvglirnsrs
iligvcflgvltlviswaslglefsfavgasdfcvspdsyitkvtrenavinqdilqyyl
kcsmgqtnpfqqklsgshkalvemqddvsellrsairdfpktksnleemqgvlnstevsl
hhltalvdcrslhmdyvqaltglcydgvegliylvlfsfvtalmfssivcsvphtwqskr
seeedgdetsatlgsraphdnlyrvhmpslyscgsstygneaslpaaahtvsnapvteym
sqnanfqtprcentpligrespppsytssmrakylatsrpdqprptesqnglepnmrpdl
tsrsapnsrpnsaihrphsaih

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University