N-Glycosylated Protein Data

Protein Summary

ID: neural cell adhesion molecule 3
Protein Name: neural cell adhesion molecule 3
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
446 (R)DGFQLPNAnTSNIK(I) Trypsin 760.3736 1,518.73 2 95% 39.51 26.11

Protein Sequence

mfptkaiilvllffdnavslqvditpahgeisvgesrfflceviggakeidwfapageki
epgrpdisvirndetsstltiynakvdnagtyrcvassgdqdaeatvnlkiyqkitftnv
pspqeftegdnaiivcdvissppptvlwkykgakiqfdkdvrfktlsnnhlqirgirktd
egvytcegrikargevdfrsikvvvnvlptirirqaetnatadmgfstllacdpdgfpep
ivtwrrnnaplesgnkysfnedgsemtvldvtkldegdytciaknkageseqelslkvfv
qpkitylesqtttemdeqvtltceatgdptptitwsfgtrvftegeqaswtrpeqhkgpd
gevlvrsdarvssltlkypqytdagqylctarnaigetvqpvslevryapkilgsvavyt
wegnpaniscevlahpsdvsitwl[rDGFQLPNANTSNIKi]hntpsasylevnpesqsd
fgnynctasneigtesrefimipadvpsapsigevqpysstaqvlfeepestggvpvlky
raewravgrgkwvqrvyevkdglssvtvtglkpetdyevkmsaingkgegdsspsmvfkt
ehvqgepsppilegtlqpkgnslkvkwikqddggspithylvrykaredsewkpeirlps
gseyvmligldwdteydvfvvaenqqgkskpgtltfrtsseptattdsmedgpglntgvi
vgililvcvllllivdatccflnkcgilmcicgkpgqstkgkdietgkaafvqdvskepi
vevrteeeatanhdaeghlepnettpltepeqvtetaaavvdlplsvptnsdtitdtfdl
sqsspvsesttltssitappsdpinpvhmtppdsstpkthsrpsisssdpanvtllvdla
evspavpseepvqvpssptsvdhpgtiiskvtenesvqspshaalnpispqgdiavplvn
heleidgelplasdtdatqdgshaggtagssgpsapaqdekiledenaelkkvapdagfe
pnavtqtnieska

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University