N-Glycosylated Protein Data

Protein Summary

ID: novel solute carrier protein
Protein Name: novel solute carrier protein
Protein Symbol:
Protein Function: transporter
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
553 (K)GLTVSnTSAR(G) Trypsin 503.7608 1,005.51 2 95% 41.45 25.87

Protein Sequence

syvelnelrgeiwqetgrwvgfeenfspatgqwsqshvsyltfksliqlrkvmstgavll
dvddsslssigqkmveqlllkkeirpsdrdalvtilqrkrryvcgrksfnfflfsvldfy
ssvvenlqkpvvafarlrdsvvmegvleasipvrfvfflvgpshsgmdyhesgramaalm
adwvfsleaylatnerdlynamadfmdcsivipptdiqddsmlkpiinfqkkmlhdrvrp
ydtrimvggkaptgpakpredplartglpfggmvkdikrrykhylsdftdaldpqvlsav
ifiyfaalspaitfgglladktehmmgvsemmvstcvqgvifclfaaqpvlvigftgplm
vfeeaffqfckgygfeyivgrvwvgmwlivivviimavegsflvrfisrftqeifsilis
lifiyetfsklikifkahplilnyehlndslddpfhpikkvinvtlhpdgnvtehheiie
raypntallsmclmfgcffialylrgfktstflpgpirrmvgdfgvpiaiffmiavdisi
sdaytqklvvp[kGLTVSNTSARg]wfispfgekktfpvwmmfacvvpamlvfilifles
qittlivskperkmvkgsgfhvdllllvflggvgslfgvpwlsaatvrsvthanaltvmt
kgprpqiervleqrvsgilvavmvgvsilmepilkmipmtalfgiflymgitslsgiqlw
drmlllitpkkhhpavpyvtrvptmrmhlytliqvmclallwvvkssnfslalpfvlilt
iplrmfmtghvftvmemkcldaddanvkfddedd

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University