N-Glycosylated Protein Data

Protein Summary

ID: procollagen type I alpha 1 chain
Protein Name: procollagen type I alpha 1 chain
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
373 (L)RLMSTEASQnITY(H) Chymotrypsin 765.8627 1,529.71 2 95% 44.95

Protein Sequence

gkqgpsgpsgergppgpmgppglagppgepgregtpgnegsagrdgaagpkgdrgetgps
gtpgapgppgaagpigpagktgdrgetgpagvpgpagpsgprgpsgpagargdkgetgea
gergmkghrgftgmpgppgppgpsgesgpagasgpagprgpagsagsagkdgmsglpgpi
gppgprgrngeigpagppgppgppgapgpsgggfdigfiaqpqekapdpfrhfraddanv
mrdrdlevdttlkslsqqiesiispdgtkknpartcrdlkmchpdwksgeywidpdqgcn
qdaikvycnmetgetcvnptesaipkknwytsknikekkhvwfgeamtdgfqfeygsegs
kpedvniqltf[lRLMSTEASQNITYh]cknsiaymdqasgnlkkalllqgsneieirae
gnsrftysvtedgctshtgawgktvidykttktsrlpiidiapmdvgapnqefgievgpv
cfl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University