N-Glycosylated Protein Data

Protein Summary

ID: putative galactose-binding protein
Protein Name: putative galactose-binding protein
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
73 (F)SVGPAGQLGVnGTY(Y) Chymotrypsin 660.8275 1,319.64 2 67% 32.17

Protein Sequence

mycgamkvyqgvllllscqilytlaldctimngnlkqidagsgsvvgvndlnqafvlqdd
vfnpvskslkh[fSVGPAGQLGVNGTYy]ifklmsgrfvqfpgllkqvdaggdqiiagvn
mnddifclnmdannqwpssttpwvtlngklkyyscgpysccgvnsadrifimkgvssnac
sgdgtfvnipgllsmievgtdgsvfgvnyeaklfqrvgvsrsnpagtdwismiacpighk
hvsldlgvlwvvcvdgsirkctl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University