N-Glycosylated Protein Data

Protein Summary

ID: vitellogenin 3 precursor
Protein Name: vitellogenin 3 precursor
Protein Symbol:
Protein Function: lipid transporter activity; response to chemical stimulus; lipid transport
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
888 (K)YEMnLTPSK(S) Trypsin 550.2538 1,098.49 2 95% 37.39 22.30
1041 (K)RDEnTSCEER(K) Trypsin 648.7601 1,295.51 2 95% 28.98 15.19
1232 (K)KIPSPIELVGIEAAnLTMST(-) Trypsin 1,051.06 2,100.11 2 95% 78.24 25.24

Protein Sequence

rlclcllvalaasemanyepflnsqktyeykyeglvqvgrelphlvesalklrctfkiig
esphtfvlqvsnvdfedfngipgksvfspsknitkylsaeisqpiiseyskgqitdirTA
PGVSNTVVNIVRgilgflqvtvkttqsfyelielgihglcqssytvdedsnpkelivtri
vditncqqpaslyrgmalapedklskqrgesvvstvkhtytvkstadggqitkafaqerq
yfspfnvkggnfrmlalrdiellkvsdttdkvvtgqvqsrgnlmyktnkdlkpipvvmln
lndpvpkildlikrlaqaniyhvdsetsteildliqlmrvttldnlehlwkqvsgndehr
rwfldlvvevtderilkflearykagditaneagqalvvafnhlsaepvsvalaqeslti
pfskshpllwntvvlaygslvhrycvytdpcpitvvqpllnmaasslsknsedemvlalk
slgnaahlssiktllkflpgysngaeklstrVQGAAVQAFRllasraphsvqdivlnlfv
qkhlpaeirmlacivlletmpstalisvvsevlleeadlqvasfsysllkgfaksrtpdn
qhlsiacniamkiltrklghlsyrysknlhfdwfhddflfgtsadvymlqnespiptklm
lkgkfhfigrilqflefgiradglkdlfagkIPELTKDLGISDLASILKilsnwqslpkd
kplltayarvfgqeaflmdvsrdsvqsiiksfspsagkeskvweriqdvqkgtswhwtkp
hlvyearfiqptclglpveiskyysvvnavtmqakaeinpppkehlgellssdismqtdg
figvtkdhflfhgintdlfqcgtelkskvsmglpwafdlkinpkeq[kYEMNLTPSKs]v
telfsvssnvyavsrniedptsskitpmmpetgeswqgvplrmlpplrdeqskksgmkfr
qcaeakiygtalcieaeakrahylheyplyyllgdthfsyslepakdakpiekiqiqvsa
srqhpsvmsgmvnlnqrvfke[krdentsceerk]tssslpvtqdldvtpdpvvtvkals
lspqakplgyegvafylptaqkddiemivsevgeeanwkmcanahfdrthtsakahlrwg
aecqtydvsmrvsaacqpeskpsistkinwgtlpsvfttvgqivqeyvpgvsyimgfyqk
neenperqasvtvvasspetfdlkvkipertiyk[kKIPSPIELVGIEAANLTMST]

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University