N-Glycosylated Protein Data

Protein Summary

ID: Acetylcholinesterase precursor
Protein name: Acetylcholinesterase precursor
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
325 (L)INDCNCnASML(K) Chymotrypsin 664.75 1327.48 2 95% 32.97 20.17

Protein Sequence

maiscrqsrvlpmslplpltiplplvlvlslhlsgvcgvidrlvvqtssgpvrgrsvtvq
grevhvytgipyakppvedlrfrkpvpaepwhgvldatglsatcvqeryeyfpgfsgeei
wnpntnvsedclyinvwapakarlrhgrganggehpngkqadtdhlihngnpqnttnglp
iliwiygggfmtgsatldiynadimaavgnvivasfqyrvgafgflhlapempsefaeea
pgnvglwdqalairwlkdnahafggnpewmtlfgesagsssvnaqlmspvtrglvkrgmm
qsgtmnapwshmtsekaveigka[lINDCNCNASMLk]tnpahvmscmrsvdaktisvqq
wnsysgilsfpsaptidgaflpadpmtlmktadlkdydilmgnvrdegtyfllydfidyf
dkddatalprdkyleimnnifgkatqaereaiifqytswegnpgyqnqqqigravgdhff
tcptneyaqalaergasvhyyyfthrtstslwgewmgvlhgdeieyffgqplnnslqyrp
verelgkrmlsaviefaktgnpaqdgeewpnfskedpvyyifstddkieklargplaarc
sfwndylpkvrswagtcdgdsgsasisprlqllgiaaliyicaalrtkrvf

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University