N-Glycosylated Protein Data

Protein Summary

ID: Protein sevenless
Protein name: Protein sevenless
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
639 (Y)FAmESPERNqSSF(Q) Chymotrypsin 773.83 1545.64 2 95% 33.67 30.71

Protein Sequence

mtmfwqqnvdhqsdeqdkqakgaaptkrlnisfnvkiavnvntkmttthinqqapgtsss
ssnsqnaspskivvrqqsssfdlrqqlarlgrqlasgqdghggistiliinllllillsi
ccdvcrshnytvhqspepvskdqmrllrpkldsdvvekvaiwhkhaaaappsivegiais
srpqstmahhpddrdrdrdpseeqhgvdermvlervtrdcvqrciveedlfldefgiqce
kadngekcyktrctkgcaqwyralkelescqeaclslqfypydmpcigacemaqrdywhl
qrlaishlvertqpqlerapradgqstpltirwamhfpehylasrpfniqyqfvdhhgee
ldleqedqdasgetgssawfnladydcdeyyvceilealipytqyrfrfelpfgenrdev
lyspatpayqtppegapisapviehlmglddshlavhwhpgrftngpiegyrlrlssseg
natseqlvpagrgsyifsqlqagtnytlalsminkqgegpvakgfvqthsarnekpakdl
tesvllvgrravmwqslepagensmiyqsqeeladiawskreqqlwllnvhgelrslkfe
sgqmvspaqqlkldlgnissgrwvprrlsfdwlhhrl[yFAMESPERNQSSFq]iistdl
lgesaqkvgesfdlpveqlevdalngwifwrneeslwrqdlhgrmihrllrirqpgwflv
qpqhfiihlmlpqegkfleisydggfkhplplpppsngagngpasshwqsfallgrslll
pdsgqlilveqqgqaaspsaswplknlpdcwavillvpesqpltsaggkphslkallgaq
aakiswkepernpyqsadaarswsyelevldvasqsafsirnirgpifglqrlqpdnlyq
lrvrainvdgepgewteplaartwplgphrlrwasrqgsvihtnelgeglevqqeqlerl
pgpmtmvnesvgyyvtgdgllhcinlvhsqwgcpiseplqhvgsvtydwrggrvywtdla
rncvvrmdpwsgsrellpvfeanflaldprqghlyyatssqlsrhgstpdeavtyyrvng
legsiasfvldtqqdqlfwlvkgsgalrlyrapltaggdslqmiqqikgvfqavpdslql
lrplgallwlersgrrarlvrlaapldvmelptpdqaspasalqlldpqplpprdegvip
mtvlpdsvrlddghwddfhvrwqpstsggnhsvsyrlllefgqrlqtldlstpfarltql
pqaqlqlkisitprtawrsgdttrvqlttppvapsqprrlrvfverlatalqeanvsavl
rwdapeqgqeapmqaleyhiscwvgselheelrlnqsalearvehlqpdqtyhfqvearv
aatgaaagaashalhvapevqavprvlyanaefigeldldtrnrrrlvhtaspvehlvgi
egeqrllwvnehvellthvpgsapaklarmraevlalavdwiqrivywaeldatapqaai
iyrldlcnfegkilqgervwstprgrllkdlvalpqaqsliwleyeqgsprngslrgrnl
tdgselewatvqplirlhagslepgsetlnlvdnqgklcvydvarqlctasalraqlnll
gedsiagqlaqdsgylyavknwsiraygrrrqqleytvelepeevrllqahnyqayppkn
clllpssggsllkatdceeqrcllnlpmitasedcplpipgvryqlnltlargpgseehd
hgveplgqwllgageslnltdllpftryrvsgilssfyqkklalptlvlaplelltasat
pspprnfsvrvlsprelevswlppeqlrsesvyytlhwqqeldgenvqdrreweaherrl
etagthrltgikpgsgyslwvqahatptksnsserlhvrsfaelpelqllelgpyslslt
wagtpdplgslqlecrssaeqlrrnvagnhtkmvveplqprtryqcrlllgyaatpgapl
yhgtaevyetlgdapsqpgkpqlehiaeevfrvtwtaargngapialynlealqarsdir
rrrrrrrrnsggsleqlpwaeepvvvedqwldfcnttelscivkslhssrlllfrvrars
lehgwgpyseeservaepfvspekrgslvlaiiapaaivsscvlalvlvrkvqkrrlrak
kllqqsrpsiwsnlstlqtqqqlmavrnrafsttlsdadiallpqinwsqlkllrflgsg
afgevyegqlktedseepqrvaikslrkgasefaellqeaqlmsnfkhenivclvgicfd
tesislimehmeagdllsylraaratstqepqptaglslsellamcidvangcsyledmh
fvhrdlacrnclvtestgstdrrrtvkigdfglardiyksdyyrkegegllpvrwmspes
lvdglfttqsdvwafgvlcweiltlgqqpyaarnnfevlahvkeggrlqqppmcteklys
llllcwrtdpwerpsfrrcyntlhaistdlrrtqmasatadtvvscsrpefkvrfdgqpl
eehrehnerpedenltlrevplkdkqlyanegvsrl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University