N-Glycosylated Protein Data

Protein Summary

ID: acyl coenzyme A:diacylglycerol acyltransferase
Protein name: acyl coenzyme A:diacylglycerol acyltransferase
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
555 (F)KNSLnGTDYSS(-) Chymotrypsin 593.76 1185.52 2 91% 28.67 30.34

Protein Sequence

mttnkdpqdkepgkaeqptknsgssgvgimkrlrrsasatehnlsslrnrkstqnlfdqh
gnpidlrqyrkvldkdengngtngsekklryrrtqsvtraeeisnkeekqrraqpgrpih
rprdslfswssgftnfsglvnwgflllcigglrlglenllkygirinpldwfffisghne
geghnalilsiyslvhislclavekglameiiaeglglfiqivnivvlvclpvvtihlkg
hafslmgastvcffysvlflklwsyvqtnmwcrqtyyqknprerrpsitlaelkkgvlng
geededvsklvqypdnltyndllyflcaptlcyelnfprtsrvrkrfllkrllevvigvn
vvmalfqqwiipsvrnslipfsnmdvalaterllklalpnhlcwlcffylmfhsflnavg
ellnfadrnfycdwwnannidtfwrtwnmpvhrwcvrhlyipvvqmgyssrqastivflf
savfheylvsvplqiykiwafmgmmgqiplsaisksiekklgprmgniivwasiilgqpl
cimayyhdyvvqh[fKNSLNGTDYSS]

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University