N-Glycosylated Protein Data

Protein Summary

ID: laminin A chain
Protein name: laminin A chain
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
1348 (F)HITHnASDF(C) Chymotrypsin 521.73 1041.45 2 95% 33.90 29.29
1605 (F)DMWPVPADEILLnETTL(K) Chymotrypsin 987.47 1972.93 2 95% 39.27 32.28
2192 (Y)AKQVnQTLAnAF(D) Chymotrypsin 653.34 1304.67 2 95% 101.03 31.68
2264 (L)GQInGTSIELTPNEQVL(E) Chymotrypsin 907.4617 1812.9088 2 21% 13.80 31.57
2294 (L)VLPIKAQnKSLNAL(K) Chymotrypsin 755.45 1508.89 2 95% 31.86 21.52
2564 (W)KNSNAnASDALEIL(K) Chymotrypsin 730.87 1459.72 2 95% 62.63 32.14
2694 (L)LATRTnLSTY(F) Chymotrypsin 570.8 1139.58 2 69% 19.41 29.73
2882 (F)KGnGYVQLnATSNL(K) Chymotrypsin 740.87 1479.72 2 95% 41.04 33.04
3485 (F)LESEVKnLTDF(K) Chymotrypsin 648.32 1294.63 2 94% 32.54 33.09

Protein Sequence

mghgvasigallvilaisycqaeltppyfnlatgrkiyatatcgpdtdgpelycklvgan
tehdhidysviqgqvcdycdptvpernhppenaidgteawwqspplsrgmkfnevnltin
feqefhvaylfirmgnsprpglwtlekstdygktwtpwqhfsdtpadcetyfgkdtykpi
trdddvictteyskivplengeipvmllnerpsstnyfnstvlqewtratnvrirllrtk
nllghlmsvarqdptvtrryfysikdisiggrcmcnghadtcdvkdpkspvrilacrcqh
htcgiqcneccpgfeqkkwrqntnarpfncepcnchghsneckydeevnrkglsldihgh
ydgggvcqncqhntvgincnkckpkyyrpkgkhwnetdvcspcqcdyffstghceeetgn
cecraafqppscdscaygyygypncrececnlngtngyhceaesgqqcpckinfagayck
qcaegyygfpeckacecnkigsitndcnvttgeckcltnfggdncerckhgyfnyptcsy
cdcdnqgteseicnkqsgqcicregfggprcdqclpgfynypdckpcncsstgssaitcd
ntgkcnclnnfagkqctlctagyysypdclpchcdshgsqgvscnsdgqclcqpnfdgrq
cdsckegfynfpscedcncdpagvidkfagcgsvpvgelckckervtgricneckplywn
lnisntegceicdcwtdgtisaldtctsksgqcpckphtqgrrcqecrdgtfdldsaslf
gckdcscdvggswqsvcdkisgqckchpritglactqpltthffptlhqfqyeyedgslp
sgtqvrydydeaafpgfsskgyvvfnaiqndvrnevnvfksslyrivlryvnpnaenvta
tisvtsdnplevdqhvkvllqptsepqfvtvagplgvkpsaivldpgryvfttkanknvm
ldyfvllpaayyeagiltrhisnpcelgnmelcrhykyasvevfspaatpfvigenskpt
npvetytdpehlqivshvgdipvlsgsqnelhyivdvprsgryifvidyisdrnfpdsyy
inlklkdnpdsetsvllypclysticrtsvnedgmeksfyinkedlqpviisadiedgsr
fpiisvtaipvdqwsidyinpspvcvihdqqcatpkfrsvpdskkiefetdhedriatnk
ppyasldervklvhldsqneativieskvdatkpnlfvilvkyyqpshpkyqvyytltag
knqydgkfdiqhcpsssgcrgvirpagegsfeiddefkftittdrsqsvwldylvvvplk
qynddllveetfdqtkefiqncghdh[fHITHNASDFc]kksvfsltadynsgalpcncd
yagstsfechpfggqcqckpnviertcgrcrsryygfpdckpckcpnsamcepttgecmc
ppnvigdlcekcapntygfhqvigceecacnpmgiangnsqcdlfngtcecrqniegrac
dvcsngyfnfphceqcschkpgtelevcdkidgacfckknvvgrdcdqcvdgtynlqesn
pdgcttcfcfgktsrcdsaylrvynvsllkhvsittpefheesik[fDMWPVPADEILLN
ETTL
k]adftlrevnderpayfgvldyllnqnnhisayggdlaytlhftsgfdgkyivap
dvilfsehnalvhtsyeqpsrnepftnrvnivesnfqtisgkpvsradfmmvlrdlkvif
iranyweqtlvthlsdvyltladedadgtgeyqflavercscppgysghscedcapgyyr
dpsgpyggycipcecnghsetcdcatgicskcqhgtegdhcercvsgyygnatngtpgdc
micacplpfdsnnfatsceisesgdqihceckpgytgprcescangfygepesigqvckp
cecsgninpedqgscdtrtgeclrclnntfgaacnlcapgfygdaiklkncqscdcddlg
tqtcdpfvgvctchenvigdrcdrckpdhygfesgvgcracdcgaasnstqcdphtghca
cksgvtgrqcdrcavdhwkyekdgctpcncnqgysrgfgcnpntgkcqclpgvigdrcda
cpnrwvlikdegcqecnnchhalldvtdrmryqidsvledfnsvtlafftsqklnyydql
adelepkvklldpnsvdlspskkanselesdaks[yAKQVNQTLANAFd]irerssttlg
nitvaydeavksadqakeaiasvealsknleaaastkidaaleqaqhilgqingtsielt
pneqvlekarklyeevnt[lVLPIKAQNKSLNALk]ndigefsdhledlfnwseasqaks
adverrnvanqkafdnskfdtvseqklqaeknikdagnflingdltlnqinqkldnlrda
lnelnsfnknvdeelpvredqhkeadaltdqaeqkaaelaikaqdlaaqytdmtasaepa
ikaataysgiveaveaaqklsqdaisaagnatdktdgieerahladtgstdllqrarqsl
qkvqddleprlnasagkvqkisavnnatehqlkdinklidqlpaesqrdm[wKNSNANAS
DALEIL
k]nvleilepvsvqtpkelekahginrdldltnkdvsqankqlddvegsvskln
elaedieeqqhrvgsqsrqlgqeienlkaqveaarqlansikvgvnfkpstilelktpek
tk[lLATRTNLSTYf]rttepsgfllylgndnktaqknndfvaveivngypiltidlgng
peritsdkyvadgrwyqavvdrmgpnakltireelpngdvvehsksgylegsqnilhvdk
nsrlfvggypgisdfnappdlttnsfsgdiedlkigdesvglwnfvygddndqgarerdv
llekkkpvtglr[fKGNGYVQLNATSNLk]srssiqfsfkadkdtsngllffygrdkhym
siemidgaiffnislgegggvqsgsqdryndnqwhkvqaerenrngllkvddivisrtna
pleadlelpklrrlyfgghprrlntsislqpnfdgcidnvvinqgvvdlteyvtgggvee
gcsakfstvvsyapheygflrmnnvssdnnlhvvlhfkttqpngvlfyaanhdqsstigl
slqdgllklnsmgsqlviddrilndgedhvvtvqhtqgelrltvddvdnkrlgspqplil
eggdiffaglpdnyrtprnalaslayfvgcisdvtvneeiinfansaekkngningcpph
vlayepslvpsyypsgdnevespwsnadtlpplkpdiestlppttptttttttttttstt
ttstttttttpspivideekeieaktpqkilttrppaklnlpsdercklpeqpnfdvdft
eagyrfyglreqrlqinslpvkvrrhhdigisfrterpnglliyagskqrddfiavylld
grvtyeirvgaqlqakitteaelndgtwhtvevvrtqrkvsllidkleqpgsvdlnaers
apvlavelpiylggvnk[flesevknltdfk]tevpyfngclknikfdamdletppeefg
vvpcseqverglffnnqkafvkifdhfdvgtemkisfdfrprdpngllfsvhgknsyail
elvdntlyftvktdlknivstnyklpnnesfcdgktrnvqaikskfviniavdfissnpg
vgnegsvitrtnrplflgghvafqrapgiktkksfkgciskvevnqrminitpnmvvgdi
wqgycpln

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University