N-Glycosylated Protein Data

Protein Summary

ID: olfactory-specific protein Os9
Protein name: olfactory-specific protein Os9
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
70 (R)LPGLPAnETIDR(Q) Trypsin 648.8412 1295.6678 2 95% 46.96 27.97
159 (L)VSnVTQLATETEDSLITTF(L) Chymotrypsin 1035.51 2069 2 95% 35.85 32.44

Protein Sequence

marsgrrssrfliggstccwvllgliclaladsaqvkersptilagntiqaverlfnqvl
ystiedarqrlpalpanetidrqyfeeldlvagnedyystafyifawinsdlmyhktpdk
llvevlpgekiairrffakvkphltkylrlsrqdrse[lVSNVTQLATETEDSLITTFl]
efpqnlksqlpelqlmdytklaqalvqgvasgiwtka

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University