N-Glycosylated Protein Data

Protein Summary

ID: position-specific antigen 2 alpha-subunit precursor; integrin precursor; PS2
Protein name: position-specific antigen 2 alpha-subunit precursor; integrin precursor; PS2
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
203 (F)SAAInGnGSRLF(I) Chymotrypsin 604.8 1207.58 2 95% 57.06 31.57
957 (L)VSnSTDAGDKL(R) Chymotrypsin 554.26 1106.51 2 95% 67.38 32.42
990 (F)VHRDRASQAVQEPQVnQTSF(T) Chymotrypsin 766.71 2297.12 3 86% 27.71 32.37
1302 (L)AVAnVTLLPF(I) Chymotrypsin 523.3 1044.59 2 57% 16.39 28.36

Protein Sequence

msgdsihrrrmalhcpitslillliamsghgynidlpsyvrfrqssnsmfgfsiamhkgr
sgfygnqnnvslivgapkfdtsryqqgvteaggvfkcslndddcklvpfdskgnnrnvdk
evvdrksyqwlgatvatgrdsdlvvacapryvfhtmtpsrafridpvgtcftshnfeefy
evspcrtnnwgyhrqgscqag[fSAAINGNGSRLFi]gapgswywqgqtysippdakfpf
kpplyqpfgtggmasshdvtrpenqvfstsesasvnddsylgysmvtgdfdgdrsedvai
gmprggnlvgrivvnrwnmanifnitgrqigeyfgyslatsdvdgdglddlligapmytd
pdnvegkydvgrvyillqggpteekrwttehirdgyhskgrfglalttlgdvngdgygdf
avgapydgpegrgvvyifhgspmgplakpsqiikseqlvegapyprtfgfalsggldmdg
ntypdlavgayssdqvfifksrpvaavnaetsfasnsklislddrscqlvrdhkkvpcml
lttcwsytgrylpeqldfdvswlldakkllnprmfflrdegknirnqtirlnygqkycln
etvylldkvqdkltplevearynlrssrpldpmvrhrrsilepvidqnreivlrdainiq
kncgpdnicepdlklkvstvdkylfgspeplvievfisntnedafeaafymvtppdlqfr
klqqlgekkdtpitcspptpennhtlkcdignplesgkiahfkislvpeekygssssydf
yweanstnlekpgseydnkirqsvgiwvdtdldikgtslpdyqlykaddykelenatked
digpqvvhiyeirnnrpsiieeaevfihlpyetivgdplmyllnqpetggkiqcddvafn
eynllldeklvkksylqaqgaiwnsaqvsgqsssssssggasvhiekargegfvrgv[lV
SNSTDAGDKL
r]sqasgataqedtlealgdas[fvhrdrasqavqepqvnqtsft]tyst
sssssgsgapsaqlrghstqghiqmagpvqhtssssssnyrswpaqqqhqqlllagsggs
glgspvtfndksqfggrnnnfhtgtldlgtlnrgnvdnelyrsqgqyqnpsqslgqsqgq
fqananqghyqgqnqaqfqarnpgfqgqtsyqgqtqysgqpggyqthhvtyssgskpyyg
renedfydednlqqatpghwssssssssssgtrrlrrsddkdgatkkpqqidlnspcqsa
rcksircvvtnlgtedgdaafvairarmvaktmeklasnvplnvst[lavanvtllpfi]
gapkdaivktheifykaepeplqvpdvvplwvvvlaacagaliflllvwllykcgffnrn
rptdhsqerqplrngyhgdehl

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University