N-Glycosylated Protein Data

Protein Summary

ID: putative thrombospondin
Protein name: putative thrombospondin
Protein Symbol:
Protein Function: unknown function
Annotation Symbol:

Identified N-Linked Glyco-Peptides

NXS/T Location Identified Sequence Enzyme Used Observed Mass Predicted Mass Charge  Probability Mascot
Ion Score
Mascot Identity Score
102 (F)EIPNInETSTIRSL(A) Chymotrypsin 794.42 1586.82 2 95% 48.18 31.12

Protein Sequence

mnwtrvlligltalaltfvevaslsldpvasaeleqfirkgdvvistrhirprrklhisi
ealfmidfpmlkhkmsffldrkqqrvtldisangatesrn[fEIPNINETSTIRSLa]lq
fsknritlhvdckasthhdidmnlaklytqmddpviklfrerkyplhfdgdmehslqran
cqkgnhrrgnrrmlrnkitereknkkrdvrgwyeptiaregvvdhrhqevptdvergdip
vlngdcedalarslsdllalvkllredvahqrqeiaylrmllencagcknplttdnqlri
epdcrsanpcypgvecldsaagprcghcplgfigdgksckpgvtcahhmcypgvqchdtv
ngaqcdscpagyegdgrtcslrnpcldtpcpsgaqclqvgyppyfhciscpmghevngts
crdmnecllydpcdelatctnlspgfqcspcpvgfdgthahgyfadyysvdyrrqtcldv
decrtgffrcpehstcineigsyrcqchegyvtngtyscldrssvfmcpdgtvcdrnavc
lrmdnirhkchcnvgwagnglicgrdtdvdgwpdqaigcpelhcqrdncpklpnsgqeda
dldghgdgcdddadgdnvqnsqdncwlaynteqldsdgdkvgdvcdncvlkynprqldtd
edglgdecdgdidndsipnaldncpllpnpsqsdvdndgvgdacdncpnlpnpdqkdrdm
dfvgdachrdidgdddgvpnsldncpmvsnsdqldtdgdgtgdecdddmdgdgipnykdn
cplaknpkqddfnrngkgdsceddedvdgvpngmdncpnnsmihhtdfrtlqtipldpkg
lsqadpnwvvhangteivqtlnsdpglavgkdafggvdfdgtfyinddtdddyagfvfsy
qssykyyvvqwkkgtqtyweprpftasaapgiqiklvnstegpgpmmrnslwhegntdge
arllwkdpkniawkertsyrwslvhrpaiglirlqmhegnrlifdsgnvfdstlkggrlg
vfcfsqrmiiwsnlqykcnnrvkpliyndlsdylktkvelqd

Legend:  [abcdef] - indicates identified peptide



© 2014 Johns Hopkins University